DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and CG5087

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster


Alignment Length:241 Identity:51/241 - (21%)
Similarity:90/241 - (37%) Gaps:50/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SYDPNIG-PYYINHLAQSTQLEDPRQEWKTVQEQMLSDYLSAAQD-QLENKREMFDVKQQRLLWA 172
            |..||.| ..|:..|...|.|:.|:.....:....::.|::...: ::..::..|.:....||  
  Fly   511 SLGPNCGMKEYLELLKSETNLQKPQTAMLMLFCDCMTHYVTILDEHEMYTEQNPFKLNDYVLL-- 573

  Fly   173 QEEY--NHLKLAASRSSLCSSSSSMSRHDPELLRADLMLARER----------VHQLKQELTHIT 225
              .|  |::.......:|.:.:.::.:|...|....|||...|          .|.|..|:...|
  Fly   574 --TYFLNNILYKLINDNLLAGAKNIVQHPVFLSLHTLMLCLYRRDCRRPFTPPKHWLIPEVKPST 636

  Fly   226 --NDISYTERGMNTLYSVGEKINARENGCYDIAEV-HAI-REEMLKVHKSLVSGEKVREELMRS- 285
              ||:              ||  |:.|....:|:: |.| .|:.:|:.:..|..||....|..| 
  Fly   637 FINDL--------------EK--AKRNAMLLLAKMPHIIPHEDRVKLFRKFVQNEKAVMGLTESA 685

  Fly   286 -------LVQIKN----ELGRQQISEENSDLASPFDRVCVASQTDL 320
                   |:.|..    |.|.:|::.:.:.......||...:|..|
  Fly   686 CASPRSALIVIHRDRIVEDGYRQLAAQPTQALKGVIRVRFINQQGL 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809 8/22 (36%)
C2_Kibra 693..813 CDD:176062
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 8/38 (21%)
HECTc 718..1075 CDD:214523 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.