DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and CG3356

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:304 Identity:67/304 - (22%)
Similarity:112/304 - (36%) Gaps:103/304 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 DSGVFEASRAH----LPRKEL------AQVQIGLKYLKQEGVLVVSLERANNLLALWTASADNSQ 730
            |:.:.:.|.:|    :|.:.|      :.||   :|:|.|.||...:||....|.     |.|..
  Fly   145 DTCLLQLSLSHTAQAIPLRMLETFTTVSSVQ---QYMKDEAVLFQYMERVFGFLI-----ARNYF 201

  Fly   731 VYLRAALLPNSLTSIRTKALGDFQKPVFNDTFAVPITLD----KLLTKSLQVTVVTMTGQK---- 787
            |.||             :.|.|...|:..:|...|..|.    :||.:.|:|......|.:    
  Fly   202 VRLR-------------RLLDDKCPPLDGETLHAPSPLAEALLQLLLRPLEVAKRASAGGQMSSM 253

  Fly   788 ---------EEIIGTVQISMAEFNPEDSTLKWYNVLSSKFIPSFE-SLDIP------STSAAAAA 836
                     .:|:.|         |....|:::      .:|.|. ::|.|      |...|..:
  Fly   254 SMAVCRNFTRDILAT---------PHTDPLRYF------VLPCFALNVDFPFDLLMRSLYDALES 303

  Fly   837 AAVAASNAPNPGNN-------------REESSDESTITSS-------QTSTLTRNQAPCMELQEQ 881
            |..|.|::.:...:             |.:|...|.:.:|       |.:||  :|:|.:.:..:
  Fly   304 AGPAESDSTSSRRSFLFYGVETGHKTTRMDSIFSSFLLNSLMVLDRRQLATL--HQSPLLVIYVR 366

  Fly   882 MAAELLG----------LGPLNEP-ECSDDDDDDEEEELDDKQL 914
            :.||::.          .|..|.| ...|.|||.||.|.:|::|
  Fly   367 LIAEMMPNILQLPKSTLRGHANAPHRHRDGDDDSEESEDEDEEL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062 30/136 (22%)
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
HECTc 788..1119 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.