DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and yki

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:223 Identity:52/223 - (23%)
Similarity:75/223 - (33%) Gaps:88/223 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLQQTASQSQHHLHPHHLR----PQQQQQQHH-------------HHHQQQQQQ--------- 39
            :|.||...|.....|..||.|    |...||.::             :.:...|||         
  Fly   145 IPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPEN 209

  Fly    40 -------------------------------QHTHHQQQQQHHSDFP---------LPDGWDIAK 64
                                           ..|.|::|:.:....|         ||.||:.||
  Fly   210 SAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAK 274

  Fly    65 DFDGKTYYIDHINKKTTWLDPRDCY-------------------TKPQTFEDCVGDE---LPMGW 107
            ..||:.||::|..|.|.|.|||..|                   |..||....:.:.   ||.||
  Fly   275 TNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGW 339

  Fly   108 EESYDPNIGPYYINHLAQSTQLEDPRQE 135
            |::...:...|:|||:.::|...|||.:
  Fly   340 EQAVTESGDLYFINHIDRTTSWNDPRMQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 15/29 (52%)
WW 103..132 CDD:278809 10/28 (36%)
C2_Kibra 693..813 CDD:176062
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 34/107 (32%)
WW 266..295 CDD:395320 14/28 (50%)
WW 335..364 CDD:395320 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4781
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.