DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and Herc3

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001102101.1 Gene:Herc3 / 362377 RGDID:1307803 Length:1050 Species:Rattus norvegicus


Alignment Length:316 Identity:66/316 - (20%)
Similarity:117/316 - (37%) Gaps:66/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 MFDVKQ-QRLLWAQE----EYNHLKLAASRSSLC-SSSSSMSRHDPELLRADLMLARERVHQLKQ 219
            ||...| ..|||..:    |:|...|......|. .:|:.:..|.|..|...|:..:..:..|| 
  Rat   765 MFTYYQDSNLLWFSDTCFVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPSLEDLK- 828

  Fly   220 ELTHITNDISYTE-RGMNTLYSV-GEKINARENGCYDIAEVHAIREE--MLKVHKSLVSGEKV-- 278
                   ::|.|| |.:..|... ||.|  .|..|.:..   ..||.  :::..|.:..|::|  
  Rat   829 -------ELSPTEGRSLQELLDYPGEDI--EETFCLNFT---VCRESYGVIEQKKLIPGGDRVAV 881

  Fly   279 ----REELMRSLVQIKNELGRQQISEENSDLASPFDRVCVASQTDL----------CGSSGENLN 329
                |:|.:.:.|   |.:.:..:.|..:..:|.|.:||.....:|          .|:|..|..
  Rat   882 CKDNRQEFVDAYV---NYIFQISVHEWYTAFSSGFLKVCGGKVLELFQPAELRAMMVGNSNYNWE 943

  Fly   330 GGARFAEMAKTKWQYAEWRKHIKKLQQQLADHVERIEPGQLESDKDRILLIQEKEKL-LNDLNSI 393
               ...|.|..|..|:.....:|...       |......||..|..:|.:...::: :..:.|:
  Rat   944 ---ELEETAVYKGDYSSTHPTVKLFW-------ETFHEFPLEKKKRFLLFLTGSDRIPIYGMASL 998

  Fly   394 SLKSRSEEEKRVIHQTRHKLEEDLKEAYEANNTCVANRLRFHEEKQLLLDKLQEAL 449
                      :::.|:....|:.|..|:...|..   .|..:..|:::..:|.:||
  Rat   999 ----------QIVIQSTATGEDYLPVAHTCYNLL---DLPKYSSKEIMKARLTQAL 1041

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062
Herc3NP_001102101.1 ATS1 2..331 CDD:227511
RCC1 313..377 CDD:395335
HECTc 702..1048 CDD:238033 66/316 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.