DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and CG4238

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster


Alignment Length:426 Identity:83/426 - (19%)
Similarity:127/426 - (29%) Gaps:159/426 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   892 LNEPECSDDD-------------------DDDEEEELDDKQLVSDVGLMNSSSMLHA-----YLQ 932
            :.:..||.:|                   ..|.....|...|||.:   |...::||     ...
  Fly     1 MGQMHCSPEDASLRSDLVLIRSFVVYKGRPPDHATRFDISMLVSHI---NVGGVMHAATGGKTFP 62

  Fly   933 NMKQEFADKETNTDRAYLPEKSRGQSQLMDDRPVKRSQTFTPSEAFSKNRYNCRLNRSDSDSAMH 997
            .:|.:....|           |.|.|.|......:|.....|.:       ..||.|    :|:|
  Fly    63 TLKVKLCFGE-----------SMGISSLSSCGDPERLPELPPLD-------EQRLQR----AALH 105

  Fly   998 CGVAPHTFQRGAAERRSLRFHSKAPKSVTKLHHTHIPRTSLDLELDLQAQHSKLYFLND------ 1056
                   .|:....|..|:.|        :|.| |..|. |.:|:   |....:|:|.|      
  Fly   106 -------LQQKLILREWLKDH--------RLQH-HYQRL-LAVEV---ASLEDVYWLEDSRASKI 150

  Fly  1057 -----QI------------AKLQNLK----EVLQKACENKDPLVAAW--------AIENEEFQRL 1092
                 |:            |:|..||    ..:.|:.:::|    ||        ::.......|
  Fly   151 LGKDWQLWSGARQNLPTSKAQLDALKAQLWSTVVKSSQHQD----AWTWGGMLVVSVSVAGLVTL 211

  Fly  1093 VARADPAKCPEERQLQKLLMKTAKEIHKLRKTKVPKGCPDLVSFKEK----------ITFFTRKG 1147
            .|...|:..||.|. ..|...|.|.:       :|..|.....:|:.          :.||.|.|
  Fly   212 AAMTQPSLAPEARH-SLLQYVTGKYL-------LPANCKVQWDWKDPASVGGTMCFVVRFFQRNG 268

  Fly  1148 LSVPELPSEFTLPEAN-------PIEEEEEEEDENEFYNSAETAIAINTA-------LVASSNRN 1198
            ...|...::....|..       .|.|.....|.|. .|.|:....:.||       |:.:|   
  Fly   269 QPYPICDTDHFFVEVTEGTRKVVTISELGSSTDPNN-ANIAKVKFTVRTAGQYKISVLIGAS--- 329

  Fly  1199 KNLSEHPHRATS--------GAVPKIPAPVVTPAAT 1226
                   |.|.|        ||:....:..:.||:|
  Fly   330 -------HIAGSPFLRSFLPGAIDARRSRFIRPAST 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720 22/108 (20%)
Filamin 238..336 CDD:279024 22/108 (20%)
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.