DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and Bag3

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_038891.4 Gene:Bag3 / 29810 MGIID:1352493 Length:577 Species:Mus musculus


Alignment Length:471 Identity:106/471 - (22%)
Similarity:169/471 - (35%) Gaps:143/471 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 ERLKSFSSESTFSISSGSSLGSLSTASSKSALSFTDI---YIDPFAVDSPIDVVD----LRRRSQ 514
            ||.:|.::....|.||.:||.|    |.:|:|....:   ||       ||.|:.    .|..:|
Mouse   175 ERSQSPAASDCSSSSSSASLPS----SGRSSLGSHQLPRGYI-------PIPVIHEQNITRPAAQ 228

  Fly   515 RLFQQHQQQRLH---------PVHPVLQQQQ----------SAEVTLSP-RSSLSMETPPA---- 555
            ..|  ||.|:.|         |..||..:.|          :|....|| |.:.|.|..||    
Mouse   229 PSF--HQAQKTHYPAQQGEYQPQQPVYHKIQGDDWEPRPLRAASPFRSPVRGASSREGSPARSGT 291

  Fly   556 -----SPMKYNAGADQ-TPQALKEEPTYA------NALPAPPAYTAPP-PVPISGVRARPYDLDS 607
                 ||::.:...|: .|...:|.|...      .:.|.|.....|| .:||..:|.       
Mouse   292 PVHCPSPIRVHTVVDRPQPMTHREPPPVTQPENKPESKPGPAGPDLPPGHIPIQVIRR------- 349

  Fly   608 TVLDCMMLEAKLQKLNMGTP-------LNLAVAPL---SPISEKPSLLDLPQEMLSRSSSTSNTR 662
                    ||..:.::..:|       :.::.||:   || |..||.:..|.:.::     :..:
Mouse   350 --------EADSKPVSQKSPPPAEKVEVKVSSAPIPCPSP-SPAPSAVPSPPKNVA-----AEQK 400

  Fly   663 SVSAAVSNESVAGDSGVFEASRAHLPRKELAQVQIGLKYLKQEGVL--VVSLERANNLLALWTAS 725
            :..:....|..|..||..|....| |         |:  ||.|.:|  |..||:|.:  :.....
Mouse   401 AAPSPAPAEPAAPKSGEAETPPKH-P---------GV--LKVEAILEKVQGLEQAVD--SFEGKK 451

  Fly   726 ADNS----QVYLRAALLPNSLTSIRTKALGDFQKPVFNDTFAVPITLDKLLTKSL----QVTVVT 782
            .|..    :.||...||  :|.|:..:...|.::...:....|...|:||..|::    ||.|..
Mouse   452 TDKKYLMIEEYLTKELL--ALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYE 514

  Fly   783 MTGQK-------EEIIGTVQISMAEFNPEDSTLKWYNVLSSKFIPSFESLDIPSTSAAAAAAAVA 840
            :....       :||:|.|.....:..||:..            |..||..:.:          .
Mouse   515 LQPSNLEAEQPLQEIMGAVVADKDKKGPENKD------------PQTESQQLEA----------K 557

  Fly   841 ASNAPNPGNNREESSD 856
            |:..|||.|..:.:.:
Mouse   558 AATPPNPSNPADSAGN 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062 31/136 (23%)
Bag3NP_038891.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
WW 23..55 CDD:197736
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..207 12/35 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..427 48/230 (21%)
BAG 426..503 CDD:214591 21/82 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..577 14/72 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.