DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and Wwtr1

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001020040.1 Gene:Wwtr1 / 295062 RGDID:1559609 Length:395 Species:Rattus norvegicus


Alignment Length:257 Identity:61/257 - (23%)
Similarity:99/257 - (38%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QQHTHHQQQQQHHSD-FPLPDGWDIAKDFDGKTYYIDHINKKTTWLDPRDCYTKP----QTFEDC 98
            |||.|.:||....:| .|||.||::.....|:.|:::||.|.|||.|||....:|    ......
  Rat   108 QQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKVMNQPLNHVNLHPTI 172

  Fly    99 VGDELPMGWEESYDPNIGPYYINHLAQ---STQLEDPRQEWKTVQEQMLS--DYLSAAQDQLENK 158
            ....:|........||:.   :||..|   :|.|.......:.....::|  :.|:..|.|.:..
  Rat   173 TSTSVPQRSMAVSQPNLA---MNHQHQQVVATSLSPQNHPAQNPPTGLMSVPNALTTQQQQQQKL 234

  Fly   159 R-EMFDVKQQRLLWAQEEYNHLKLAASRSSLCSSSSSMSRHDPELLRADLMLARERVHQLKQELT 222
            | :...::::|:...|||     |....::||.          :|......:|......:..::.
  Rat   235 RLQRIQMERERIRMRQEE-----LMRQEAALCR----------QLPMETETMAPVNTPAMNTDMR 284

  Fly   223 HITNDIS--------YTERGMNTLYSVGEKINARENGCYDIAEVHAIREEMLKVHKSLVSGE 276
            .:||..|        |..|..:|...:|       .|||   .|....|:.|.....:.:||
  Rat   285 SVTNSSSDPFLNGGPYHSREQSTDSGLG-------LGCY---SVPTTPEDFLSNMDEMDTGE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 13/29 (45%)
WW 103..132 CDD:278809 8/31 (26%)
C2_Kibra 693..813 CDD:176062
Wwtr1NP_001020040.1 WW 125..156 CDD:197736 14/30 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.