DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and Wwp2

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001099654.1 Gene:Wwp2 / 291999 RGDID:1310091 Length:870 Species:Rattus norvegicus


Alignment Length:506 Identity:97/506 - (19%)
Similarity:168/506 - (33%) Gaps:174/506 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QQTASQSQHHLHPHHLRPQ--QQQQQHHHHHQQQQQQQHTHHQQQQQHHSD-------------- 53
            ::|..:.:.:...|:.|..  |:....:..:.:|.|.|....|...||.|.              
  Rat   338 KRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHD 402

  Fly    54 --FPLPDGWDIAKDFDGKTYYIDHINKKTTWLDPRDCYTKPQTFEDCVGDELPMGWEESYDPNIG 116
              .|||.||:..:| :|:.||::|..:.|.|.|||   |:....|..    ||.|||..|.....
  Rat   403 PLGPLPPGWEKRQD-NGRVYYVNHNTRTTQWEDPR---TQGMIQEPA----LPPGWEMKYTSEGV 459

  Fly   117 PYYINHLAQSTQLEDPRQEWKTVQEQMLSDYLSAAQDQLENKREMFDVKQQRLLWAQEEY----- 176
            .|:::|..::|..:|||..:::                 ..|:......::...|...::     
  Rat   460 RYFVDHNTRTTTFKDPRPGFES-----------------GTKQGSPGAYERSFRWKYHQFRFLCH 507

  Fly   177 -----NHLKLAASRSSLCSSS----SSMSRHDPELLRADLM-------------LARERVHQLKQ 219
                 :|:|::.||.:|...|    .:|..:|   ||..|.             :|||....|..
  Rat   508 SNALPSHVKISVSRQTLFEDSFQQIMNMKPYD---LRRRLYIIMRGEEGLDYGGIAREWFFLLSH 569

  Fly   220 ELTHITNDISYTERGMNTLYSVGEKINARENGCYDIAEVHAIR---------------------- 262
            |:             :|.:|.:.| ...:.|.|..|....:|.                      
  Rat   570 EV-------------LNPMYCLFE-YAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGK 620

  Fly   263 -----------EEMLKVHKSLVSGEKVREELMRSLVQIKNELGRQQISEENSDLASPFDRVCVAS 316
                       :.||....:|...|.:..|...|::.||          ||:             
  Rat   621 FIDTGFTLPFYKRMLNKRPTLRDLESIDPEFYNSIIWIK----------ENN------------- 662

  Fly   317 QTDLCG---------------SSGENLNGGARFAEMAKTKWQY----AEWR--KHIKKLQQQLAD 360
             .|.||               ::.|...||.......:.|.:|    .:||  :.:::..:...|
  Rat   663 -LDECGLELFFIQDMEILGKVTTHELKEGGENIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLD 726

  Fly   361 HVERIEPGQLESDKDRILLIQEKEKLLNDLNSISLKSRSEEEKRVIHQTRH 411
            ....:.|.:.....|.    :|.|.:|..:..|.:   |:.:|..|:  ||
  Rat   727 GFNEVAPLEWLRYFDE----KELELMLCGMQEIDM---SDWQKNAIY--RH 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 12/29 (41%)
WW 103..132 CDD:278809 9/28 (32%)
C2_Kibra 693..813 CDD:176062
Wwp2NP_001099654.1 C2_E3_ubiquitin_ligase 17..142 CDD:175988
WW 302..331 CDD:278809
WW 332..361 CDD:278809 4/22 (18%)
WW 407..435 CDD:278809 11/28 (39%)
WW 447..477 CDD:238122 10/29 (34%)
HECTc 516..868 CDD:238033 54/303 (18%)
HECTc 539..867 CDD:214523 48/280 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.