DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and HERC4

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:377 Identity:67/377 - (17%)
Similarity:131/377 - (34%) Gaps:135/377 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 REMFDVKQQRLLWAQE-----EYNH--LKLAASRSSLCSSSSSM-SRHDPELLRADLMLARERVH 215
            :|:.|::...:.|.|:     :.||  .:||....::|:..... ::....||:.|.:|      
Human   646 QELIDIRNDYINWVQQQAYGMDVNHGLTELADIPVTICTYPFVFDAQAKTTLLQTDAVL------ 704

  Fly   216 QLKQELTHITNDISYTERGMNTLYSVGEKIN-------ARENGCYDIAEVHAIRE---------- 263
            |::..:     |.::.:...:....|.|.:|       .|||...|..||  :|:          
Human   705 QMQMAI-----DQAHRQNVSSLFLPVIESVNPCLILVVRRENIVGDAMEV--LRKTKNIDYKKPL 762

  Fly   264 EMLKVHKSLVSGEKVREE----LMRSLVQIKNELGR----------QQISEENSDLASPFDRVCV 314
            :::.|.:..|....||:|    :||.|:..|..:.|          ...:.|:|||   |..:.|
Human   763 KVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDL---FHLIGV 824

  Fly   315 ASQTDLCGSSGENLNGGARFAEMAKTKWQYAEWRKHIKKLQQQLADHVERIEPGQLESDKDRILL 379
                 :||.:..|       ..:....:..|.::|.:||            :|.           
Human   825 -----ICGLAIYN-------CTIVDLHFPLALYKKLLKK------------KPS----------- 854

  Fly   380 IQEKEKLLNDLNSISLKSRSEEEKRVIHQTRHKLEEDLKEAYEANNTCVANRLRFHEEKQLLLDK 444
            :.:.::|:.|:.            |.:.|.....|:|::|.:..|.|.........|.|:|:|: 
Human   855 LDDLKELMPDVG------------RSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLN- 906

  Fly   445 LQEALKSTKLLEERLKSFSSESTFSISSGSSLGSLSTASSKSALSFTDIYID 496
                                            |:.:..:.::...|.|.|:|
Human   907 --------------------------------GADTAVNKQNRQEFVDAYVD 926

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 49/279 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.