DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and WWTR1

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001161750.1 Gene:WWTR1 / 25937 HGNCID:24042 Length:400 Species:Homo sapiens


Alignment Length:268 Identity:67/268 - (25%)
Similarity:105/268 - (39%) Gaps:50/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QQHTHHQQQQQHHSD-FPLPDGWDIAKDFDGKTYYIDHINKKTTWLDPRDCYTKP---QTFEDCV 99
            |||.|.:||....:| .|||.||::.....|:.|:::||.|.|||.|||....:|   ......|
Human   108 QQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAV 172

  Fly   100 GD-ELPMGWEESYDPNIGPYYINH-----LAQST--QLEDPRQEWKTVQEQMLSDYLSAAQDQLE 156
            .. .:|........||:   .:||     :|.||  |...|.|........|.:...:..|.|.:
Human   173 SSTPVPQRSMAVSQPNL---VMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQK 234

  Fly   157 NKREMFDVKQQRLLWAQEEYNHLKLAASRSSLCSSSSSMSRHDPELLRADLML---ARERVHQLK 218
            .:.:...::::|:...|||     |....::||       |..|  :.|:.:.   |......:.
Human   235 LRLQRIQMERERIRMRQEE-----LMRQEAALC-------RQLP--MEAETLAPVQAAVNPPTMT 285

  Fly   219 QELTHITNDIS--------YTERGMNTLYSVGEKINARENGCYDIAEVHAIREEMLKVHKSLVSG 275
            .::..|||:.|        |..|..:|...:|       .|||   .|....|:.|.....:.:|
Human   286 PDMRSITNNSSDPFLNGGPYHSREQSTDSGLG-------LGCY---SVPTTPEDFLSNVDEMDTG 340

  Fly   276 EKVREELM 283
            |...:..|
Human   341 ENAGQTPM 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 13/29 (45%)
WW 103..132 CDD:278809 9/35 (26%)
C2_Kibra 693..813 CDD:176062
WWTR1NP_001161750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..117 5/8 (63%)
WW 125..156 CDD:197736 14/30 (47%)
Required for interaction with PALS1. /evidence=ECO:0000269|PubMed:21145499 222..400 30/151 (20%)
PDZ-binding 394..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.