DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and Nedd4

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001344927.1 Gene:Nedd4 / 17999 MGIID:97297 Length:1207 Species:Mus musculus


Alignment Length:517 Identity:118/517 - (22%)
Similarity:191/517 - (36%) Gaps:161/517 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LPDGWDIAKDFDGKTYYIDHINKKTTWL------DPRD---CYTKPQTFEDCVGDELPMGWEESY 111
            ||.||:..:|..|::||:||.:|.|||.      |||.   .:.:.:|..:.:| .||.||||..
Mouse   727 LPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDDPRSKIPAHLRGKTDSNDLG-PLPPGWEERT 790

  Fly   112 DPNIGPYYINHLAQSTQLEDPRQEWKTVQEQMLSDYLSAAQDQLENKREMFDVKQQRLLWAQEEY 176
            ..:...::|||..:.||.||||     :|...::..........:.|.|.|    :|.|..|.:.
Mouse   791 HTDGRVFFINHNIKKTQWEDPR-----LQNVAITGPAVPYSRDYKRKYEFF----RRKLKKQTDI 846

  Fly   177 -NHLKLAASRSSLCSSS----SSMSRHDPELLRADLML-------------ARERVHQLKQELTH 223
             |..::...|:::...|    ..:.|.|  ||:|.|.:             |||....:.:|:  
Mouse   847 PNKFEMKLRRANILEDSYRRIMGVKRAD--LLKARLWIEFDGEKGLDYGGVAREWFFLISKEM-- 907

  Fly   224 ITNDISYTERGMNTLYSVGE---------KINARENGCYD--------IAEVHAIREEMLKVHKS 271
                       .|..|.:.|         :||.....|.:        |..|..    |...|..
Mouse   908 -----------FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAG----MAVYHGK 957

  Fly   272 LVSGEKVR---EELMRSLVQIKN--ELGRQQISE-----ENS----DLASPFDRVCVASQTDLCG 322
            |:.|..:|   :.:::.|:.:.:  .:..:..|.     ||.    ||....|.       :|.|
Mouse   958 LLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTELDLRFIIDE-------ELFG 1015

  Fly   323 SSGEN--LNGGARFAEMAKTKWQY----AEWRKHIKKLQQQLADHVERIEPGQLE---SDKDRIL 378
            .:.::  ..||:......|.|.:|    .:|| .:.::|:|:|...|    |..|   .|..:|.
Mouse  1016 QTHQHELKTGGSEIVVTNKNKKEYIYLVIQWR-FVNRIQKQMAAFKE----GFFELIPQDLIKIF 1075

  Fly   379 LIQEKEKLLNDLNSISLKSRSEEEK---------RVIH-----------QTRHKLEE-------- 415
            ...|.|.|:..|..:.:....|..|         :|||           :.|.:|.:        
Mouse  1076 DENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVIHWFWKAVWMMDSEKRIRLLQFVTGTSRV 1140

  Fly   416 ---DLKEAYEAN-------------------NTCVANRLRF--HEEKQLLLDKLQEALKSTK 453
               ...|.|.:|                   :||. |||..  :|....|.||||.|:::|:
Mouse  1141 PMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCF-NRLDLPPYESFDELWDKLQMAIENTQ 1201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 15/35 (43%)
WW 103..132 CDD:278809 12/28 (43%)
C2_Kibra 693..813 CDD:176062
Nedd4NP_001344927.1 C2 <477..530 CDD:326325
WW 574..602 CDD:238122
WW 727..756 CDD:306827 14/28 (50%)
WW 781..813 CDD:197736 15/36 (42%)
HECTc 874..1203 CDD:214523 73/360 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.