DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and Y92H12A.2

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001293292.1 Gene:Y92H12A.2 / 171719 WormBaseID:WBGene00022358 Length:724 Species:Caenorhabditis elegans


Alignment Length:412 Identity:82/412 - (19%)
Similarity:133/412 - (32%) Gaps:128/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QQHHSDFPLPDGWDIAKDFDGKTYYIDHINKKTTWLDPR-DCYTKPQTFEDCVGDE---LPMGWE 108
            ::...:..||||||:....:|:|::|||..|.|||.||| ...|:.........||   ||.|||
 Worm   264 EEEEDELRLPDGWDMQVAPNGRTFFIDHRTKTTTWTDPRPGAATRVPLLRGKTDDEIGALPAGWE 328

  Fly   109 ESYDPNIGPYYINHLAQSTQLEDPRQEWKTVQEQMLS---------DYLSAAQDQLENKREMFDV 164
            :....:...::|:|..:.||.||||.|.:.:....:.         :||.:...:..:.....|:
 Worm   329 QRVHADGRVFFIDHNRRRTQWEDPRFENENIAGPAVPYSRDYKRKVEYLRSRLPKPNSNSGKCDM 393

  Fly   165 KQQRLLWAQEEYNHLKLAASRSSLCSSSSSMSRHDPELLRADLML-------------ARERVHQ 216
            ...|....::.|.|:               |.:.|.: ||..|.:             .||....
 Worm   394 VVHRDTLFEDSYRHI---------------MDKKDYD-LRNKLWIEFFGETGLDYGGVTREWFFL 442

  Fly   217 LKQELTHITNDISYTERGMNTLYSVGE---------KINARENGC-------------------- 252
            |..::             .|..|.:.|         :||.....|                    
 Worm   443 LSHQI-------------FNPYYGLFEYSATDNYTLQINPHSEACNPEHLSYFHFIGRIIGMAIY 494

  Fly   253 ----YDIAEVHAIREEMLKVHKSLVSGEKVREELMRSLVQIKNELGRQQISEENSDLASPFDRVC 313
                .|...:....:.||....:|...|.|..|...||:.:|:.              .|.|...
 Worm   495 HGKLLDAFFIRPFYKMMLGKKITLFDMESVDNEYYNSLIYVKDN--------------DPADLEL 545

  Fly   314 VASQTDLCGSSGENL----NGGARFAEMAKTKWQYAEWRKHIKKLQQQLADHVERIEPGQLESDK 374
            ..|..|......:|:    ||.                  ::...:....:::|.:.|..|.   
 Worm   546 TFSLDDSIFGETQNIELIPNGA------------------NVPVTEDNKEEYIEAVVPSNLL--- 589

  Fly   375 DRILLIQEKEKLLNDLNSISLK 396
             |:....|.|.|:..|..|.:|
 Worm   590 -RLFDANELELLMCGLQKIDVK 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 17/30 (57%)
WW 103..132 CDD:278809 10/28 (36%)
C2_Kibra 693..813 CDD:176062
Y92H12A.2NP_001293292.1 C2 20..147 CDD:301316
WW 170..198 CDD:278809
WW 272..301 CDD:278809 15/28 (54%)
WW 323..353 CDD:197736 11/29 (38%)
HECTc 393..721 CDD:238033 44/283 (16%)
HECTc 415..720 CDD:214523 39/246 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.