DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and herc-1

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_490834.1 Gene:herc-1 / 171700 WormBaseID:WBGene00021685 Length:1019 Species:Caenorhabditis elegans


Alignment Length:393 Identity:66/393 - (16%)
Similarity:121/393 - (30%) Gaps:167/393 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KTYYIDHINKKTTWLDPRDCYTKPQTFEDCVGDELPMGWEESYDPNIGPYYINHLAQSTQL---- 129
            :|:|||.:|   |.:|.:..|....|.:|      |...|..|..:. |:.:|.:|:...:    
 Worm   586 ETFYIDELN---TSVDLKLEYVLELTRQD------PNKTELDYWTHF-PFLLNGVAKGELIFVEA 640

  Fly   130 ----------------------EDPRQEWKTVQEQMLSDYLSA---------------------A 151
                                  |.|..|....:|.::||.::.                     |
 Worm   641 WLMQTLRRQSSLFNTAHGTIIFELPHLELTVRREFIVSDTMNQMAGLSESDLQKPLKVNIAGEDA 705

  Fly   152 QDQLENKREMFDVKQQRLL------WAQEEYNHLK-LAASRSSLCSSSSSMSRHDPELLRADLML 209
            .|....::|.|.:..:::|      ::::|.:||. .:...|..|.                   
 Worm   706 DDAGGVRKEFFILVMRKILQSDYGMFSEDEESHLVWFSGLPSEFCD------------------- 751

  Fly   210 ARERVHQL--------------------------------KQELTHITND--------ISYTERG 234
             ||:.|||                                .::|..::..        :||.|..
 Worm   752 -REQFHQLGRLVGLSIYNHSIVPFPFPLALYKYLLDTPPDLEDLCELSPSEGKGLKMLLSYEEDD 815

  Fly   235 MNTLYSVGEKINARENGCYD---IAEVHAIREEMLKVHKSLVSG--EKV-----REELMRSLVQI 289
            :..::.:        |.|..   :.|.|.         ..|:||  ||.     |:|.:|..|..
 Worm   816 VEDVFGL--------NFCISFNILGETHT---------TELLSGGTEKPVTNANRDEYVRLYVHH 863

  Fly   290 KNELG------------RQQISEENSDLASPFDRVCVASQTDLCGSSGENLNGGARFAEMAKTKW 342
            :.|||            |:..||........|.:.|...:. :.|:...:.|   .|.::...:.
 Worm   864 RLELGYNGEIAQQALLFRKGFSESLHSRTLRFFQPCELKEM-IVGNENYDWN---EFRDILMYRG 924

  Fly   343 QYA 345
            :|:
 Worm   925 EYS 927

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 7/17 (41%)
WW 103..132 CDD:278809 7/54 (13%)
C2_Kibra 693..813 CDD:176062
herc-1NP_490834.1 ATS1 2..359 CDD:227511
HECTc 667..1016 CDD:238033 48/302 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.