DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and WWP1

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_008944.1 Gene:WWP1 / 11059 HGNCID:17004 Length:922 Species:Homo sapiens


Alignment Length:466 Identity:96/466 - (20%)
Similarity:161/466 - (34%) Gaps:127/466 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RPQQQQQQHHHHHQQQQQQQHTHHQQQQQHH----------SD--FPLPDGWDIAKDFDGKTYYI 73
            ||..:..::....|.|:.|.....||..|.:          :|  .|||.||:...|...:.|::
Human   411 RPTMESVRNFEQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFV 475

  Fly    74 DHINKKTTWLDPRDCYTKPQTFEDCVGDELPMGWEESYDPNIGPYYINHLAQSTQLEDPRQEWKT 138
            :|..|.|.|.|||     .|..::  .:.||.|||..|......|:::|..::|..:|||....:
Human   476 NHNTKTTQWEDPR-----TQGLQN--EEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSS 533

  Fly   139 VQEQMLSDYLSAAQDQLENKREMFDVKQQRLLWAQEEY--------NHLKLAASRSSLCSSS-SS 194
            |         :....|:..:|..      |...|...|        :|:|:..||.:|...| ..
Human   534 V---------TKGGPQIAYERGF------RWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQ 583

  Fly   195 MSRHDPELLRADLM-------------LARERVHQLKQELTHITNDISYTERGMNTLYSVGEKIN 246
            :....|..||..|.             ||||....|..|:             :|.:|.:.| ..
Human   584 IMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEV-------------LNPMYCLFE-YA 634

  Fly   247 ARENGCYDIAEVHAIREE--------------------------MLKVHKSLVSG-------EKV 278
            .:.|.|..|.....|..:                          .|..:|.::|.       |.:
Human   635 GKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESI 699

  Fly   279 REELMRSLVQIKNELGRQQISEENSDLASPFDRVCVASQTDLCGSSGENLNGGARFAEMAKTKWQ 343
            ..|...||:.|::    ..|.|...::....|...:...|     |.:...||:......:.|.:
Human   700 DTEFYNSLIWIRD----NNIEECGLEMYFSVDMEILGKVT-----SHDLKLGGSNILVTEENKDE 755

  Fly   344 Y----AEWR--KHIKKLQQQLADHVERIEPGQLESDKDRILLIQEKEKLLNDLNSISLKSRSEEE 402
            |    .|||  :.:::..:...|....:.|.|.....|.    :|.|.:|..:..:.|   ::.:
Human   756 YIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDE----KELEVMLCGMQEVDL---ADWQ 813

  Fly   403 KRVI--HQTRH 411
            :..:  |.||:
Human   814 RNTVYRHYTRN 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 11/29 (38%)
WW 103..132 CDD:278809 9/28 (32%)
C2_Kibra 693..813 CDD:176062
WWP1NP_008944.1 C2_E3_ubiquitin_ligase 17..140 CDD:175988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..388
HUL4 <307..922 CDD:227354 96/466 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.