DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kibra and YAP1

DIOPT Version :9

Sequence 1:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster
Sequence 2:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens


Alignment Length:369 Identity:92/369 - (24%)
Similarity:145/369 - (39%) Gaps:113/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QHTHHQQQQQHHSDFPLPDGWDIAKDFDGKTYYIDHINKKTTWLDPRDCY---------TKP--- 92
            ||. .|...:...|.|||.||::||...|:.|:::||::.|||.|||...         |.|   
Human   158 QHL-RQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQ 221

  Fly    93 QTFEDCVGDELPMGWEESYDPNIGPYYINHLAQSTQLEDPRQE--WKTVQEQMLSDYLSAAQ--- 152
            |...:.....||.|||::...:...|||||..::|...|||.:  :.....|.:|......|   
Human   222 QNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFGKAMNQRISQSAPVKQPPP 286

  Fly   153 ------------------------DQLENKREMFDVKQQRLLWAQEEYNHLKLAASRSSLCSSSS 193
                                    .||:.::|...:|||.||      ..::..|.|:  .:.|:
Human   287 LAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELL------RQVRPQAMRN--INPST 343

  Fly   194 SMSRHDPEL-LRADL-MLARERVHQ-------LKQELTHITNDIS--------------YTERGM 235
            :.|....|| ||:.| .|.::...|       :.|||..:|.:.|              .|:.|:
Human   344 ANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGL 408

  Fly   236 N-TLYSV----------------GEKIN-----ARENGCYDIAEVHAIREEMLKVHKSLVSGEKV 278
            : :.|||                |:.||     :::|...|..|  ||  ....|....:.|:.:
Human   409 SMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLE--AI--PGTNVDLGTLEGDGM 469

  Fly   279 R---EELMRSLVQIKNELGRQQISEENSDLASPFDRVCVASQTD 319
            .   ||||.||        ::.:|   ||:.:..:.|..|::.|
Human   470 NIEGEELMPSL--------QEALS---SDILNDMESVLAATKLD 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kibraNP_001034055.1 WW 57..87 CDD:238122 14/29 (48%)
WW 103..132 CDD:278809 11/28 (39%)
C2_Kibra 693..813 CDD:176062
YAP1XP_005271435.1 WW 174..203 CDD:238122 13/28 (46%)
WW 232..261 CDD:366073 11/28 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.