DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment kibra and magi2b

DIOPT Version :9

Sequence 1:	NP_001034055.1	Gene:	kibra / 41783	FlyBaseID:	FBgn0262127	Length:	1288	Species:	Drosophila melanogaster
Sequence 2:	XP_021326360.1	Gene:	magi2b / 100001810	ZFINID:	ZDB-GENE-141211-6	Length:	1171	Species:	Danio rerio

Alignment Length:	109	Identity:	49/109 - (44%)
Similarity:	64/109 - (58%)	Gaps:	5/109 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    46 QQQQHHSDF-PLPDGWDIAKDFDGKTYYIDHINKKTTWLDPRDCYTKPQTFEDCVGDELPMGWEE 109
            |..|.:.|. .|||.|::|....|:.|:|||..|.|:||||| ...|.:..|:|..||||.|||:
Zfish   133 QDLQENDDMGSLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPR-LAKKAKPPEECEEDELPYGWEK 196

  Fly   110 SYDPNIGPYYINHLAQSTQLEDPRQEWK---TVQEQMLSDYLSA 150
            ..||..|.||::|:.:.||.|:|..|.|   ..|:||.|..|||
Zfish   197 IDDPIYGSYYVDHINRRTQFENPVLEAKRRIQQQQQMQSQGLSA 240

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
kibra	NP_001034055.1	WW	57..87	CDD:238122	15/29 (52%)
		WW	103..132	CDD:278809	14/28 (50%)
		C2_Kibra	693..813	CDD:176062
magi2b	XP_021326360.1	NK	<1..>29	CDD:327404
		MAGI_u1	35..96	CDD:318800
		WW	145..175	CDD:238122	16/30 (53%)
		WW	190..219	CDD:306827	14/28 (50%)
		PDZ	266..349	CDD:214570
		PDZ	451..531	CDD:214570
		PDZ	622..708	CDD:214570
		PDZ_signaling	743..832	CDD:238492
		PDZ_signaling	1034..1114	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.000