DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and HHO1

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_015198.1 Gene:HHO1 / 855976 SGDID:S000006048 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:64/252 - (25%)
Similarity:96/252 - (38%) Gaps:69/252 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PKK-TARLLHRALKLAEANG-EVVMVKRSFKLT--DKQKNSSKA-----VEKMKAKKQKEKEKKA 193
            ||| |.:...:..|.|.:.| |....|.:.|.|  .|::.|||:     :|.:.|.|:::...:.
Yeast     3 PKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKTTAKKEEASSKSYRELIIEGLTALKERKGSSRP 67

  Fly   194 KVEKVLKEK-----------------IQK-----------------KEAKAKMKEKKASKEKSSK 224
            .::|.:||.                 |:|                 |.||.|..|.|..||.|.|
Yeast    68 ALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPK 132

  Fly   225 P---------TERKTKQAVKKKKPEDGTKDNPP--ASKAASSAAAQAMLETSQTAIPEA--GKKP 276
            |         |..|.|.|..|..|:...|...|  .:|.|||.::....|....::|:.  ||..
Yeast   133 PKQAATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMILKSMPQLNDGKGS 197

  Fly   277 AKTKVKLQADSSEAGKTKKS-----------RKSI--GTLAQPKAARPKVKAVKKLV 320
            ::..:|.....:.:.|.|.|           :|.:  |.|.|||.....:|..||.|
Yeast   198 SRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENGELVQPKGPSGIIKLNKKKV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 9/30 (30%)
HHO1NP_015198.1 Linker_histone 44..116 CDD:395429 11/71 (15%)
Linker_histone 179..250 CDD:395429 15/70 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.