DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and AT1G54240

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_175826.2 Gene:AT1G54240 / 841865 AraportID:AT1G54240 Length:229 Species:Arabidopsis thaliana


Alignment Length:153 Identity:32/153 - (20%)
Similarity:53/153 - (34%) Gaps:54/153 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EMPNDHPESEDSNMGEEEELPEEDEEEMEEDEEEDRQDGDEVETDNLGADRNPYPTPPPDDGSKL 83
            ::|:. |.:.||:  |.....|:.|..|..|.||||                             
plant    17 DLPSS-PAATDSS--EPSSYAEQLERLMMIDSEEDR----------------------------- 49

  Fly    84 VPPDSDNPKSMVPKPKG----TLISLALMAIGKLASRSGSSVQAIMTYLKDNGQEWKDPKKTARL 144
                         .|.|    .||..||..:  ..:.:|..|.||.|::|:..:..:|.::.   
plant    50 -------------GPSGFTTDELIFQALETV--YENHNGLDVDAIFTFIKERNELQEDFRER--- 96

  Fly   145 LHRALKLAEANGEVVMVKRSFKL 167
            |...|:...:.|:|..|...:|:
plant    97 LENQLRYLVSEGQVYKVGNLYKI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 12/57 (21%)
AT1G54240NP_175826.2 H15 50..115 CDD:197772 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.