DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and HMGA

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_172943.1 Gene:HMGA / 838055 AraportID:AT1G14900 Length:204 Species:Arabidopsis thaliana


Alignment Length:204 Identity:43/204 - (21%)
Similarity:73/204 - (35%) Gaps:19/204 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GSKLVPPDSDNPK-SMVPKPKGTLISLALMAIGKLASRSGSSVQAIMTYLKDNGQEWKDPKKTAR 143
            ||......|:.|. |:.|.|:     :.:.||..|..::|.:...|..:::...|..  |.....
plant     8 GSASDTHSSELPSFSLPPYPQ-----MIMEAIESLNDKNGCNKTTIAKHIESTQQTL--PPSHMT 65

  Fly   144 LLHRALKLAEANGEVVMVKRSFKLTDKQKNSSKAVEKMKAKKQK-EKEKKAKVEKVLKEKIQKKE 207
            ||...|...:..|:::|||.::...|......:.  :.:..||| :.|..|....|:...:...:
plant    66 LLSYHLNQMKKTGQLIMVKNNYMKPDPDAPPKRG--RGRPPKQKTQAESDAAAAAVVAATVVSTD 128

  Fly   208 AKAKMKEKKASKEKSSKPTERKTKQAVKKKKPEDGTKDNPPASKAASSAAAQAMLETSQTAIPEA 272
            ...........|:.|..|.|   |......:|    :..||......|....|....:|......
plant   129 PPRSRGRPPKPKDPSEPPQE---KVITGSGRP----RGRPPKRPRTDSETVAAPEPAAQATGERR 186

  Fly   273 GK-KPAKTK 280
            |: :|.|.|
plant   187 GRGRPPKVK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 14/57 (25%)
HMGANP_172943.1 H15 22..85 CDD:197772 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.