DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and AT5G08780

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_680160.2 Gene:AT5G08780 / 830778 AraportID:AT5G08780 Length:457 Species:Arabidopsis thaliana


Alignment Length:277 Identity:54/277 - (19%)
Similarity:102/277 - (36%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TLISLALMAIGKLASRSGSSVQAIMTYLKDNGQEWKD-PKKTARLL-HRALKLAEAN-------- 155
            |..::..:||..|....|:|..||..::|   .::|: |.....|| |...||.|..        
plant    57 TYSAMIFIAIMDLNKEGGASEDAISEFIK---SKYKNLPFAHTNLLSHHLAKLVEKREILCDCNN 118

  Fly   156 ------GEVVMVKRSFKLTDKQK---------NSSKAVEKMKAKKQKE------KEKKAKVEKVL 199
                  ||    |::...||.|:         |..:|.:::...:.||      |....||..:.
plant   119 DCYSLPGE----KKTVASTDVQRKSDLITVRTNDQRAADEVMTCQNKEESVEILKSGDPKVVLLE 179

  Fly   200 KEKIQKKEAKAKMK--------EKKASKEKSSKPTERKTKQAVKKKKPEDGTKDNPPASKAASSA 256
            ::.:.|....:|.|        |...:::...|...|.:...:.:|   :|..:......:.:.|
plant   180 EQSLTKSRTGSKRKACCVINVIEVMDTEDNGFKAGLRDSTVQIPRK---EGVVEVVDVENSENEA 241

  Fly   257 AAQA------------MLETSQTAIPEAGKKPAKT-----KVKLQADSSEAGKTKKSRKSIGTLA 304
            ..:|            :.:.:...:.|:||:..:|     |.||:..|:    |.|....:.:.|
plant   242 RIEANSRGGELYEVAVLYKQNDVLMEESGKEAMETSSIVRKAKLRRTSN----TTKENVEVTSEA 302

  Fly   305 QPKAARPKVKAVKKLVA 321
            ..|....:.:|...::|
plant   303 YKKLWECQTEACSNIIA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 19/73 (26%)
AT5G08780NP_680160.2 H15 52..113 CDD:197772 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.