DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and HON4

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_188431.3 Gene:HON4 / 821328 AraportID:AT3G18035 Length:480 Species:Arabidopsis thaliana


Alignment Length:294 Identity:70/294 - (23%)
Similarity:104/294 - (35%) Gaps:56/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NPYPT-----PPPDDGSKLVPPDSDNPKSMVPKPKGTLISLALMAIGKLASRSGSSVQAIMTYLK 129
            |||..     |.|...:::..|........|..|......:...||..|....|||..||..|::
plant    31 NPYNNHVVFQPQPQTQTQIPQPQMFQLSPHVSMPHPPYSEMICAAIAALNEPDGSSKMAISRYIE 95

  Fly   130 D--NGQEWKDPKKTARLLHRALKLAEANGEVVMVKRSFKLT-DKQKNSSKAVEKMKAKKQKEKEK 191
            .  .|.    ....|.||...||..:.:|.:.|||:|:|:. .....:|.||....|.:..:   
plant    96 RCYTGL----TSAHAALLTHHLKTLKTSGVLSMVKKSYKIAGSSTPPASVAVAAAAAAQGLD--- 153

  Fly   192 KAKVEKVLKEKIQKKEAKAKMKEKKASKEKSSKPTERKTKQAVKKKKPE---DGTKDNPPASKAA 253
                       :.:.|..........:...:|:|.:| .:....|.|||   ...:..||.::. 
plant   154 -----------VPRSEILHSSNNDPMASGSASQPLKR-GRGRPPKPKPESQPQPLQQLPPTNQV- 205

  Fly   254 SSAAAQAMLETSQTAIPEAGKKPAKTKVKLQADSSEAGKTKKSRKSIGTLAQPKAARPKVKAVKK 318
             .|..|.:.|..|...|    .|..|.|      :|:.|....|......|.| |..|.|:|  .
plant   206 -QANGQPIWEQQQVQSP----VPVPTPV------TESAKRGPGRPRKNGSAAP-ATAPIVQA--S 256

  Fly   319 LVAGKGASTPDLSIMEAQATSTPQGATKAKRKRK 352
            ::||         ||:.:  ..|.|...|.|:||
plant   257 VMAG---------IMKRR--GRPPGRRAAGRQRK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 20/59 (34%)
HON4NP_188431.3 H15 64..126 CDD:197772 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.