DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and HIS1-3

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_179396.1 Gene:HIS1-3 / 816317 AraportID:AT2G18050 Length:167 Species:Arabidopsis thaliana


Alignment Length:165 Identity:44/165 - (26%)
Similarity:77/165 - (46%) Gaps:16/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PKSMVPKPKGTLISLALMAIGKLASRSGSSVQAIMTYLKDNGQEWKDPKKTARLLHRALKLAEAN 155
            ||:....|...:|..|||.   |..::|||..||...:::..:... |:...:.|...||.:.|.
plant    19 PKTTTHPPYFQMIKEALMV---LKEKNGSSPYAIAKKIEEKHKSLL-PESFRKTLSLQLKNSVAK 79

  Fly   156 GEVVMVKRSFKLTDKQKNSSKAVEKMKAKKQKEKEKKAKVEKVLKEKIQKKEAKAKMKEKKASKE 220
            |::|.::.|:||:|..|..::..:|...|..|:::|:............||......:|||...:
plant    80 GKLVKIRASYKLSDTTKMITRQQDKKNKKNMKQEDKEITKRTRSSSTRPKKTVSVNKQEKKRKVK 144

  Fly   221 KSSKPTERKTKQAVKKKKPEDGTKDNPPASKAASS 255
            |:.:|  :..|.:|.|||          |.||:::
plant   145 KARQP--KSIKSSVGKKK----------AMKASAA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 14/57 (25%)
HIS1-3NP_179396.1 H15 21..87 CDD:197772 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.