DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and H1f8

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001102821.1 Gene:H1f8 / 502875 RGDID:1566236 Length:332 Species:Rattus norvegicus


Alignment Length:330 Identity:78/330 - (23%)
Similarity:123/330 - (37%) Gaps:74/330 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TPPPDDGSKLVP----PDSDNPKSMVPKPKGTLISLALMAIGKLASRSGSSVQAIMTYLKDNGQE 134
            |.||  ||..:|    ||....:..|.:...|::.:.|.|:.....|.|:||.||..|:     :
  Rat    20 TSPP--GSCGLPGAVSPDPSCSRIQVGQRNPTMLRMVLEALKAREKRQGTSVVAIKVYI-----Q 77

  Fly   135 WKDPK-KTARL-----------LHRALKLAEANGEVVMVKRSFKLTDKQKNSSKAVEKMKAKKQK 187
            .|.|. .|.|.           :.|.|....||.:......||||..|.|.......|.:.....
  Rat    78 HKYPTVGTTRFKYLLKQALETGMRRGLLTRPANSKAKGATGSFKLVPKPKKKRTCAPKARGGATG 142

  Fly   188 EKEKKAKVEKVLKEKIQKKEAKAKMKEKKASKEKSSKPTERKTKQAVKKKKPEDGTKDNPPASKA 252
            .||..:|     :..::||:...|.|.:||:.....|........|..:|.|::        :||
  Rat   143 TKETGSK-----ESGLRKKDQVGKAKTEKAAPNPGRKRKAYPCSAATLEKAPKN--------AKA 194

  Fly   253 ASSAAAQAMLETSQTA----IPEAGKKPAKTKVKLQADSSEAGKTK-----------KSRKSIGT 302
            ......:|.|:..:.|    ....|:|...:....:||:.  ||||           |.:.|:.:
  Rat   195 VPREVREAPLKRDKAAGAPLTANIGQKVKHSGTGQEADAH--GKTKDVCEKSKASASKVQNSVAS 257

  Fly   303 LAQPK-AARPKVKAV---KKLVAGKGASTPDLSIM-EAQATS----------------TPQGATK 346
            |.:.: ||...::.|   .|.|....|.||...:. :||.|:                .|:.::|
  Rat   258 LIKKEMAAIAHMETVVQGAKTVQKTKAPTPSQDVRHKAQPTTRVRKTKTPEDTKRPQLPPKTSSK 322

  Fly   347 AKRKR 351
            |..|:
  Rat   323 APSKK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 18/69 (26%)
H1f8NP_001102821.1 H15 44..135 CDD:238028 24/95 (25%)
PTZ00121 <127..>329 CDD:173412 46/216 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.