DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and His1:CG33825

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001027319.1 Gene:His1:CG33825 / 3772715 FlyBaseID:FBgn0053825 Length:256 Species:Drosophila melanogaster


Alignment Length:301 Identity:82/301 - (27%)
Similarity:124/301 - (41%) Gaps:75/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NPYPTPPPDDGSKLVPPDSDNPKSMVPKPKGTLIS------LALMAIGKLASRSGSSVQAIMTYL 128
            :|...||.....|:|...:........|......|      :...:|..|..|.|||:.||..|:
  Fly    11 SPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYI 75

  Fly   129 KDNGQEWK-DPKKTARLLHRALKLAEANGEVVMVKRSFKLTDKQKNSSKAVEKMKAKKQKEKEKK 192
            .   ..:| |.:|.|..:.:.||.|..||:::..        |.|.:|.:. |:.|..:|||:.|
  Fly    76 T---ATYKCDAQKLAPFIKKYLKSAVVNGKLIQT--------KGKGASGSF-KLSASAKKEKDPK 128

  Fly   193 AKVEKVLKEKIQKKEAKAKMKEKKASKEK---SSKPT-------ERKTKQAVKKKKPEDGTKDNP 247
            || .|||       .|:.|::.||.:.:|   |||.|       :.|.|:||..||    |.:|.
  Fly   129 AK-SKVL-------SAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKK----TAENK 181

  Fly   248 PASKAASSAAAQAMLETSQTAIPEAGKKPAKTKVKLQADSSEAGKTKKSRKSIGTLAQPKAARPK 312
            ...||.:.       :..:|.|.::  |||.||.|:                  |.|:|||...|
  Fly   182 KTEKAKAK-------DAKKTGIIKS--KPAATKAKV------------------TAAKPKAVVAK 219

  Fly   313 VKAVKKLVAGKGASTPDLSIMEAQATST---PQGATKAKRK 350
            ....|..|:.|    |..::.:|..::|   |:..|.|.:|
  Fly   220 ASKAKPAVSAK----PKKTVKKASVSATAKKPKAKTTAAKK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 18/58 (31%)
His1:CG33825NP_001027319.1 Linker_histone 46..118 CDD:278939 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.