DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and h1m

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_005174537.2 Gene:h1m / 327403 ZFINID:ZDB-GENE-030131-5614 Length:290 Species:Danio rerio


Alignment Length:241 Identity:70/241 - (29%)
Similarity:93/241 - (38%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PDSDNPKSMVPK--PKGTLISLALMAIGKLASRSGSSVQAIMTYLKDNGQEWKDPKKTARLLHRA 148
            |:..|.||...|  |..:.:.:...|:.:|.||.|.|.|||..|:|:. ....|..:...::.||
Zfish    63 PEDSNAKSAARKVSPHPSTMEMVKEALKELDSRKGVSAQAIRGYIKEK-YTTVDETRLKYMVRRA 126

  Fly   149 LKLAEANGEVVMVKRSFKLTDKQKNSSKAVEKMKAKKQKEKEKKAKVEKVLKEKIQKKEAKA-KM 212
            |......|..|....|...|..|.....|.      |.|.||.||:    .||.....|.|| |.
Zfish   127 LNKGMDTGVFVRPANSGSTTGAQGRFRIAA------KTKAKEAKAQ----SKENADPNEPKATKP 181

  Fly   213 KEKKASKEKSSKPTERKTKQAVKKKKPEDGTKDNPPASKAASSAAAQAMLETSQTAIPEAGKKPA 277
            |:.||:|.|....|:.|   ..|||:..|..|.........:|..|.|....::.|..|.|.||.
Zfish   182 KKAKATKAKGEGATKEK---PTKKKETTDDAKPKTSEQNGTASKVAPAKKPKAKNAAGEGGAKPK 243

  Fly   278 KTKVKLQADSSEAGKTKKSRK---------SIGTLAQPKAARPKVK 314
            .:|.|...:.:|....||..|         ..|..|..||...:.|
Zfish   244 PSKAKASKEGAEEPAAKKGGKKNAVKAEDGESGAAATEKAPGKRAK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 18/57 (32%)
h1mXP_005174537.2 Linker_histone 78..154 CDD:306920 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.