DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and H1-1

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_005316.1 Gene:H1-1 / 3024 HGNCID:4715 Length:215 Species:Homo sapiens


Alignment Length:234 Identity:70/234 - (29%)
Similarity:92/234 - (39%) Gaps:50/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TPPPDDGSKLVPPDSDNP----KSMVP---------KPKGTLIS-LALMAIGKLASRSGSSVQAI 124
            |.||...:...|   :.|    |:..|         ||.|..:| |.:.|......|.|.|:.|:
Human     4 TVPPAPAASAAP---EKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAAL 65

  Fly   125 MTYLKDNGQEWKDPKKTARLLHRALKLAEANGEVVMVK-----RSFKLTDK------QKNSSKAV 178
            ...|...|.   |.:|....:...:|...:.|.:|..|     .||||..|      :..:||..
Human    66 KKALAAAGY---DVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVA 127

  Fly   179 EKMKAKKQKEKEKKAKVEKVLKEKIQKKEAKAKMKEKK-ASKEKSSK-PTERKTKQAVKKKKPED 241
            .|.||....:|.|||       ....||..|...|.|| |:..|||| |.:.||   ||.||   
Human   128 TKTKATGASKKLKKA-------TGASKKSVKTPKKAKKPAATRKSSKNPKKPKT---VKPKK--- 179

  Fly   242 GTKDNPPASKAASSAAAQAMLETSQTAIPEAGKKPAKTK 280
             ...:|..:||....||:|.:...:||.|   ||.|..|
Human   180 -VAKSPAKAKAVKPKAAKARVTKPKTAKP---KKAAPKK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 15/62 (24%)
H1-1NP_005316.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 10/41 (24%)
Linker_histone 41..111 CDD:306920 18/72 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..215 48/138 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.