DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BigH1 and H1f8

DIOPT Version :9

Sequence 1:NP_650383.2 Gene:BigH1 / 41780 FlyBaseID:FBgn0038252 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_612184.1 Gene:H1f8 / 171506 MGIID:2176207 Length:304 Species:Mus musculus


Alignment Length:303 Identity:75/303 - (24%)
Similarity:109/303 - (35%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GADRNPYPTPPPDDGSKLVPPDSDNPKSMVPKPKGTLISLALMAIGKLASRSGSSVQAIMTYLKD 130
            |||:       |....:.:.....||         |::.:.|.|:....:|.|:||.||..|:: 
Mouse    29 GADK-------PGPSCRRIQAGQRNP---------TMLHMVLEALKAREARQGTSVVAIKVYIQ- 76

  Fly   131 NGQEWKDPKKTARLLHRALKLAEANGEVVMVKR-----------SFKLTDKQKNSSKAVEK---- 180
            :.....|..:...||.:||:.....|   ::.|           ||||..|.|.......|    
Mouse    77 HKYPTVDTTRFKYLLKQALETGVRRG---LLTRPAHSKAKGATGSFKLVPKPKTKKACAPKAGRG 138

  Fly   181 -MKAKKQKEKE----KKAKVEKVLKEKIQK---------------KEAKAKMKEKKASKEKSSK- 224
             ..||:...|:    ||.:|.|...||.||               |:||||.||.:.:..|..| 
Mouse   139 AAGAKETGSKKSGLLKKDQVGKATMEKGQKRRAYPCKAATLEMAPKKAKAKPKEVRKAPLKQDKA 203

  Fly   225 ---PTERKTKQAVKKKKPED---------GTKDNPPASKAASSAAAQA---MLETSQTAIPEAGK 274
               |......|.||:.....         |.|..|.|||..:|.|:.|   |.:.:.|.....| 
Mouse   204 AGAPLTANGGQKVKRSGSRQEANAHGKTKGEKSKPLASKVQNSVASLAKRKMADMAHTVTVVQG- 267

  Fly   275 KPAKTKVKLQADSSEAGKTKKSRKSIGTLAQPKAARPKVKAVK 317
                      |::.:..|.....:.||...||   .|:|:..|
Mouse   268 ----------AETVQETKVPTPSQDIGHKVQP---IPRVRKAK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BigH1NP_650383.2 H15 109..167 CDD:294056 17/68 (25%)
H1f8NP_612184.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 4/15 (27%)
H15 43..134 CDD:238028 25/103 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..248 38/137 (28%)
Nuclear localization signal. /evidence=ECO:0000255 154..170 8/15 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..304 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.