DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hexim and Hexim2

DIOPT Version :9

Sequence 1:NP_731932.1 Gene:Hexim / 41778 FlyBaseID:FBgn0038251 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001123987.1 Gene:Hexim2 / 71059 MGIID:1918309 Length:313 Species:Mus musculus


Alignment Length:235 Identity:66/235 - (28%)
Similarity:101/235 - (42%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GSAEKESGSQQRPLDSG---GGGGAS----GGGGVAVGGGS---GMPKRKHRRGKKSKMQPKKTK 68
            ||....||.:.:..|.|   .|.|:|    |....:.||.|   .:.::||||      :|.|.|
Mouse    40 GSQLLPSGQEIQSEDEGTVPAGDGSSCNIRGSRTQSPGGCSVEAVLARKKHRR------RPSKRK 98

  Fly    69 NHYPQWKLDMSTGAGATLEGNQRQNSRTKLVRSRSL-----LVPYNTNRFLM------EEHMSEL 122
            .|   |:..:........:.::||:.|...||....     |.||||.:|||      |.::..|
Mouse    99 RH---WRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPLAPYNTTQFLMNDRDLEEPNLDVL 160

  Fly   123 H------------KDDSDDNCFGSQTEDQVLFLSKEFSDVYERARLERLETMSKQELIQECMQIE 175
            |            ..|||     .|......|..::||:.|||...|.|:..|||||:::.:.:|
Mouse   161 HGPSHSGSGGENEAGDSD-----GQGRAHGEFQQRDFSEAYERYHTESLQGRSKQELVRDYLDLE 220

  Fly   176 DRYSKAQNISKEF----GAKLRAQDDKIRQLSRENQFLRT 211
            .|.|:|:..::..    |...|....::.:|:.|.:.|||
Mouse   221 RRLSQAEQETRRLRQLQGCSSRQPCQQVEELAAEVERLRT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeximNP_731932.1 HEXIM <107..178 CDD:291959 28/88 (32%)
Hexim2NP_001123987.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78 10/37 (27%)
HEXIM 101..226 CDD:373740 37/129 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139 6/27 (22%)
Interaction with P-TEFb. /evidence=ECO:0000250 139..142 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..194 8/43 (19%)
Interaction with CCNT1, HEXIM1 and HEXIM2. /evidence=ECO:0000250 225..286 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836946
Domainoid 1 1.000 52 1.000 Domainoid score I11405
eggNOG 1 0.900 - - E1_2CHCC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5285
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005824
OrthoInspector 1 1.000 - - otm44248
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5413
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.