DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hexim and hexim1

DIOPT Version :9

Sequence 1:NP_731932.1 Gene:Hexim / 41778 FlyBaseID:FBgn0038251 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001091859.1 Gene:hexim1 / 562319 ZFINID:ZDB-GENE-030131-4637 Length:319 Species:Danio rerio


Alignment Length:251 Identity:67/251 - (26%)
Similarity:101/251 - (40%) Gaps:77/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SGSAEKESGSQQRPLDSGGGGGASGGGGVAVGGGSG--MPKRKHRRGKKSKMQPKKTKNHY-PQW 74
            :|.|..:.|.   |.|.......|....|...|.|.  ..|:||||      :|.|.|..: |.:
Zfish    61 TGDAASDDGF---PADKTSSKRDSECAAVNTDGVSDGRQGKKKHRR------RPSKKKRRWKPYF 116

  Fly    75 KLDMSTGAGATLEGNQRQNSRTKLVRSRSL-----LVPYNTNRFLMEEHMSE------------- 121
            ||...    ...|.::|:.:|...||:...     :.||||.:||||||..|             
Zfish   117 KLTWE----EKKELDERETARASRVRAEMFAKGLPVAPYNTTQFLMEEHDREEPDLNTELGGRKS 177

  Fly   122 --LHKDD--SDDNCFGSQTEDQV-----------------LFLSKEFSDVYERARLERLETMSKQ 165
              :..:|  |:|..|.::.:|:.                 .||.|:||:.||:..:|.|:.||||
Zfish   178 GAIRSEDTASEDENFEAEEDDEEEGGGGSDGMGRPGQAGGEFLQKDFSETYEKYHVEALQNMSKQ 242

  Fly   166 ELIQECMQIEDRYSKAQNISKEFGAKLRAQDDKIRQLSRENQFLRTHLLRTCSATA 221
            ||::|.:::|...|:                     |..||.:|| |:.|...:.|
Zfish   243 ELVREYLELEKCMSR---------------------LEEENNWLR-HVRRNPESPA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeximNP_731932.1 HEXIM <107..178 CDD:291959 33/104 (32%)
hexim1NP_001091859.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..111 17/58 (29%)
HEXIM 114..255 CDD:291959 41/144 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..223 13/65 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..286 6/16 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580473
Domainoid 1 1.000 52 1.000 Domainoid score I11523
eggNOG 1 0.900 - - E1_2CHCC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005824
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109694
Panther 1 1.100 - - LDO PTHR13469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6090
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.