Sequence 1: | NP_731932.1 | Gene: | Hexim / 41778 | FlyBaseID: | FBgn0038251 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_620092.1 | Gene: | Hexim1 / 192231 | MGIID: | 2385923 | Length: | 356 | Species: | Mus musculus |
Alignment Length: | 260 | Identity: | 72/260 - (27%) |
---|---|---|---|
Similarity: | 115/260 - (44%) | Gaps: | 60/260 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EAVKNGKNRHSG----SAEKESGSQQRPLDSGGGGGASGGGGVAVGGGSGMPKRKHRRGKKS-KM 62
Fly 63 QPKKTKNHY-PQWKLDMSTGAGATLEG----NQRQNSRTKLVRSRSL-----LVPYNTNRFLMEE 117
Fly 118 HMSE--------------LHKDDSDDNCF---------------GSQTEDQVLFLSKEFSDVYER 153
Fly 154 ARLERLETMSKQELIQECMQIEDRYSKAQNISKEF---GAKLRAQDDKIRQLSRENQFLRTHLLR 215
Fly 216 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hexim | NP_731932.1 | HEXIM | <107..178 | CDD:291959 | 33/99 (33%) |
Hexim1 | NP_620092.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..162 | 21/73 (29%) | |
Basic region, mediates nuclear localization and interaction with 7SK snRNA and NR3C1. /evidence=ECO:0000250 | 147..174 | 11/34 (32%) | |||
HEXIM | 163..295 | CDD:291959 | 42/143 (29%) | ||
Interaction with P-TEFb. /evidence=ECO:0000250 | 199..202 | 2/2 (100%) | |||
Autoinhibitory acidic region, in absence of 7SK snRNA interacts with the basic region preventing interaction with P-TEFb and modulating subcellular localization. /evidence=ECO:0000250 | 207..247 | 7/39 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 210..259 | 8/52 (15%) | |||
Mediates interaction with CCNT1. /evidence=ECO:0000250 | 283..311 | 6/27 (22%) | |||
Required for inhibition of ESR1-dependent transcription. /evidence=ECO:0000250 | 307..352 | 8/29 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167836947 | |
Domainoid | 1 | 1.000 | 52 | 1.000 | Domainoid score | I11405 |
eggNOG | 1 | 0.900 | - | - | E1_2CHCC | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 72 | 1.000 | Inparanoid score | I5285 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S8077 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005824 | |
OrthoInspector | 1 | 1.000 | - | - | otm44248 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_109694 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR13469 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6090 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
12 | 11.730 |