DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hexim and hexim1

DIOPT Version :9

Sequence 1:NP_731932.1 Gene:Hexim / 41778 FlyBaseID:FBgn0038251 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002935563.3 Gene:hexim1 / 100497839 XenbaseID:XB-GENE-986997 Length:294 Species:Xenopus tropicalis


Alignment Length:246 Identity:66/246 - (26%)
Similarity:101/246 - (41%) Gaps:64/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RHSGSAEKESGSQQRPLDSGGGGGASGGGGVAVGGGSGMPKRKHRRGKKSKMQPKKTKNHY-PQW 74
            |.....:||.|. |:|      |..:.......|....:.|::|||      .|.|.|..: |..
 Frog    47 REQKDPDKEGGC-QKP------GQLAKAKPQQEGDWKELGKKRHRR------LPSKNKRKWKPYC 98

  Fly    75 KLDMSTGAGATLEGNQRQNS-RTKLVRSRSLLVPYNTNRFLMEEH-------------------- 118
            ||............:||.:. |.:::.....:.||||.:||||:|                    
 Frog    99 KLTWEEKKNLEERASQRASRIRAEMIAKGQPVAPYNTTQFLMEDHDQEEPDLCPPPRKSSTALPL 163

  Fly   119 --MSELHKDDSDDNCFGSQTEDQV-----------LFLSKEFSDVYERARLERLETMSKQELIQE 170
              ::..:|.||.|:.. .:.||:.           .||.|:||:.|||...|.|:.|||||||:|
 Frog   164 AIINSSYKGDSTDDDL-EEEEDETGSDGMGVYDGEDFLQKDFSETYERYHAESLQDMSKQELIRE 227

  Fly   171 CMQIEDRYSKAQNISKEFGAKLRAQ-----------DDKIRQLSRENQFLR 210
            .|::|...|:.:    |...:||.|           |.:|::|..|.:.|:
 Frog   228 YMELEKCLSRME----EENNRLRLQSLTSTPVADHKDSRIQELQLELEKLK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeximNP_731932.1 HEXIM <107..178 CDD:291959 35/103 (34%)
hexim1XP_002935563.3 HEXIM 94..238 CDD:405901 42/144 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11115
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005824
OrthoInspector 1 1.000 - - oto105374
Panther 1 1.100 - - LDO PTHR13469
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.100

Return to query results.
Submit another query.