DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and TMPRSS5

DIOPT Version :10

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:314 Identity:82/314 - (26%)
Similarity:127/314 - (40%) Gaps:88/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGN 130
            ||.::||.|....::....:...|              ||             ||.|.:  ..|.
Human   204 LRCSECGARP
LASRIVGGQSVAPG--------------RW-------------PWQASV--ALGF 239

  Fly   131 QEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPY 195
            :   |.|||.:::.|:|:|||||:.       .....||..|        :.|..........|:
Human   240 R---HTCGGSVLAPRWVVTAAHCMH-------SFRLARLSSW--------RVHAGLVSHSAVRPH 286

  Fly   196 QDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQ---------------- 244
            |...:|.::|||||:..:...  |:||:||.:....:|.|..:|||.|:                
Human   287 QGALVERIIPHPLYSAQNHDY--DVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGH 349

  Fly   245 ------LRADELEDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTNS 303
                  ..:|.|:|.|..:...|..:|..:..|.:|...:  |            |..|.|  .:
Human   350 THPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRML--C------------AGYLDG--RA 398

  Fly   304 QECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDS 357
            ..|.|::||||:....|.:.|.|:||:|. .|..|:.|.||.:||.::|||||:
Human   399 DACQGDSGGPLVCPDGDTWRLVGVVSWGR-GCAEPNHPGVYAKVAEFLDWIHDT 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 32..82 CDD:463440 5/15 (33%)
Tryp_SPc 111..356 CDD:238113 72/266 (27%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:464747 4/8 (50%)
Tryp_SPc 217..448 CDD:214473 73/296 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.