DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG34171

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:254 Identity:63/254 - (24%)
Similarity:108/254 - (42%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 YTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVAD 190
            :|.|:.   |.|.||::::|:|||:|||:..  .:.:.::..|:                 .||.
  Fly    49 HTPGDN---HFCTGVILTNRHVLTSAHCITD--KNGVMMSPKRI-----------------VVAL 91

  Fly   191 CAPPYQD-------IAIEELLPHPLYNRTDRTQINDIALVRLASPAKLN-DFVQPICLPNKQLRA 247
            ||..::.       :.|..::.||.|:   |.|.||||:::|....||: ..:.|:.|.|..|  
  Fly    92 CASLFKTPESEEFVVDIHNMIIHPYYH---RNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSL-- 151

  Fly   248 DELEDLVTEVAGWQASSSQRMRKGY------VTISSIEECQRKYASQQLRIQASKLCG------- 299
             |:.:....:.|......||....:      |.:...:||        |:::.|.:..       
  Fly   152 -EVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDEC--------LKVKKSLMAARPENEDL 207

  Fly   300 ----LTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
                .|..|.|..:.||||..   ||.|.|  ::.|.:.|.:|| |..::.|:.|..|:
  Fly   208 ICVKSTEKQMCTTDFGGPLFC---DGQLYG--IALGSINCSSPD-PVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 63/254 (25%)
Tryp_SPc 111..354 CDD:214473 62/252 (25%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 62/252 (25%)
Tryp_SPc 38..263 CDD:304450 63/254 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.