DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG11843

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:362 Identity:103/362 - (28%)
Similarity:153/362 - (42%) Gaps:94/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CV-AKIPSGRVTGHCISIRECDYFMRI----LLSGNLSQSDRNLLRDNQCGVRGNDVQVCCPSTA 86
            || .:.|...|.|.|...::..:..||    ||.|   .|..:.:.||            |.|..
  Fly    16 CVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPG---ASIESRIIDN------------CRSYT 65

  Fly    87 GLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHA---CGGVLISDRYVL 148
            .|....||..|                  ||||.:|.:  .|.......|   |||||||:|:||
  Fly    66 PLIVGGHPAQP------------------REFPHMARL--GRRPDPSSRADWFCGGVLISERFVL 110

  Fly   149 TAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTD 213
            |||||:   .:...::..|||||.|.          ||...|.||  :|..:...:.||.|.  |
  Fly   111 TAAHCL---ESERGEVNVVRLGELDF----------DSLDEDAAP--RDYMVAGYIAHPGYE--D 158

  Fly   214 RTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQAS------SSQRMR--- 269
            ....:||.||:|......:.:..|.|||.:..|:.:....|    ||.::      |:|.::   
  Fly   159 PQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAV----GWGSTGLALKPSAQLLKVKL 219

  Fly   270 --------KGYVTISSIEECQRKYASQQLRIQASKLC-GLTNSQE-CYGNAGGPLMLFKND---G 321
                    |..:| ..:||..|.:...      ::|| |...:|: |.|::||||:::..:   .
  Fly   220 QRYGNWVCKKLLT-RQVEEFPRGFDGN------NQLCVGSEMAQDTCNGDSGGPLLMYHREYPCM 277

  Fly   322 YLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358
            |::.|:.|.| :.|.:|..|.:||||..|:.||..:|
  Fly   278 YVVVGITSAG-LSCGSPGIPGIYTRVYPYLGWIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 12/55 (22%)
Tryp_SPc 111..356 CDD:238113 82/269 (30%)
Tryp_SPc 111..354 CDD:214473 80/267 (30%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 85/292 (29%)
Tryp_SPc 68..309 CDD:214473 83/289 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.