DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG11841

DIOPT Version :10

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:269 Identity:84/269 - (31%)
Similarity:127/269 - (47%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 TDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTS 175
            |....:|||:.|.:.:.:.|.|....|||.|||:|.|||||||.   .:.:.::..|||||.:..
  Fly    76 TPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCF---FSEHGEVNVVRLGELEFD 137

  Fly   176 TNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQI-NDIALVRLASPAKLNDFVQPIC 239
            |:.|          |..|  :|..:..|..||.:   :..|: |||.:|:|....|.|.:..|.|
  Fly   138 TDTD----------DAEP--EDFGVLALKAHPGF---ENPQLYNDIGIVQLDREVKFNRYKHPAC 187

  Fly   240 LPNKQLRADELEDLVTEVA-GW------QASSSQRMR---KGYV--TISSI---EECQRKYASQQ 289
            ||     .|:.|...:.:| ||      |..|.:.::   :||.  .:||:   :|....|..: 
  Fly   188 LP-----FDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPK- 246

  Fly   290 LRIQASKLC--GLTNSQECYGNAGGPLMLFKND---GYLLGGLVSFGPVPCPNPDWPDVYTRVAS 349
                 |:||  ...|...|.|::|||::.:..|   .|.:.|:.|.| :.|..||.|..||||..
  Fly   247 -----SQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAG-ITCSTPDIPSAYTRVHY 305

  Fly   350 YIDWIHDSL 358
            :::||...|
  Fly   306 FLNWIKGEL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 32..82 CDD:463440
Tryp_SPc 111..356 CDD:238113 83/265 (31%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 82/264 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.