DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG31199

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:334 Identity:89/334 - (26%)
Similarity:132/334 - (39%) Gaps:85/334 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILLSGNLSQSDRNL-LRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRI 115
            :||.|......|:. :.|:|||....|..:...||..        :|:                 
  Fly     9 LLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFA--------IPT----------------- 48

  Fly   116 REFPWLALIEYTRGNQEKI--HACGGVLISDRYVLTAAHC------VAQAATSNLQI------TA 166
             |..|:|.|.|.:|.:.||  :.|.|||:|.|.||..|||      ||:|.:.:|.:      ..
  Fly    49 -EHQWVARIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVG 112

  Fly   167 VRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKL 231
            ||:.|.|               ..|..|.|:|.:.|:..||.|:  .||..|.:|::.|...||:
  Fly   113 VRVCETD---------------GYCVRPSQEIKLAEIAIHPDYD--SRTLKNSLAVLTLQRDAKI 160

  Fly   232 NDFVQPICLPNKQLRADELEDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKYASQQLRIQASK 296
            ...|.|||:|...|..:.|......|||.:.....|: |.:|...|...||.|.  :.|...::.
  Fly   161 YPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDFRL-KTWVNTLSRGFCQSKV--KTLVTSSNT 222

  Fly   297 LCGLTNSQECYGNAGGPLMLFKNDG------YLLGGLVSFGPVPCPNPDWPDVYTRVAS------ 349
            :||.......| ..|.||:..:..|      ||:|.::          ||.....|:.|      
  Fly   223 VCGYHKQPVAY-YLGAPLVGLQKKGHVTQNYYLVGIMI----------DWRWENNRIMSSFLAIR 276

  Fly   350 -YIDWIHDS 357
             |:|:|..:
  Fly   277 NYMDFIRQN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 9/30 (30%)
Tryp_SPc 111..356 CDD:238113 77/271 (28%)
Tryp_SPc 111..354 CDD:214473 76/269 (28%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.