DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG5255

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:239 Identity:64/239 - (26%)
Similarity:104/239 - (43%) Gaps:55/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 HACGGVLISDRYVLTAAHCVAQAATSNLQITAVRL--GEWDTSTNPDCQYHEDSKVADCAPPYQD 197
            |:|||.:|.:|:::|||||     |...|.||.|:  |..|...|....|:.|            
  Fly    55 HSCGGAIIDERWIITAAHC-----TRGRQATAFRVLTGTQDLHQNGSKYYYPD------------ 102

  Fly   198 IAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPI------CLPNKQLRADELEDLVTE 256
                .::.|.  |...|...|||||:.|......::..||:      .:|..:|       |:| 
  Fly   103 ----RIVEHS--NYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRL-------LLT- 153

  Fly   257 VAGWQASS-----SQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTNSQE--CYGNAGGPL 314
              ||...|     ..|::...|.....|:|:..: ....|:....:|...:...  |:|::||||
  Fly   154 --GWGTLSLGGDVPARLQSLEVNYVPFEQCRAAH-DNSTRVDIGHVCTFNDKGRGACHGDSGGPL 215

  Fly   315 MLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358
            :   ::|.|: .||::| :||.. .:||.:..::.|.|:|...|
  Fly   216 V---HNGKLV-ALVNWG-LPCAK-GYPDAHASISYYHDFIRTHL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 63/235 (27%)
Tryp_SPc 111..354 CDD:214473 62/233 (27%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 62/233 (27%)
Tryp_SPc 30..252 CDD:238113 63/236 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.