DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG17477

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:239 Identity:66/239 - (27%)
Similarity:101/239 - (42%) Gaps:53/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 HACGGVLISDRYVLTAAHCVAQAATSNLQIT--AVRLGEWDTSTNPDCQYHEDSKVADC---APP 194
            |.|||.:||||:::||.|||....||.||:.  .:|..|      |...|:.|:....|   :|.
  Fly    51 HLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAE------PGAVYYPDAIYLHCNYDSPK 109

  Fly   195 YQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAG 259
            ||                     |||.|:.|......|...|.:.||.........|.:.|   |
  Fly   110 YQ---------------------NDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFT---G 150

  Fly   260 WQASSS--------QRMRKGYVTISSIEECQRKYASQQLRIQASKLCGL--TNSQECYGNAGGPL 314
            |.:.|:        ||:::.::...:.|.....|  :.|.:....:|..  .|...|:|::||||
  Fly   151 WGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAY--EDLELGPCHICAYRQANIGACHGDSGGPL 213

  Fly   315 MLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358
            :   :.|.|:|.|..|  |||.. ..||::..:..|.||:..::
  Fly   214 V---HQGTLVGILNFF--VPCAQ-GVPDIFMNIMYYRDWMRQTM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 66/235 (28%)
Tryp_SPc 111..354 CDD:214473 65/233 (28%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 66/236 (28%)
Tryp_SPc 27..246 CDD:214473 64/232 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.