DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and modSP

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:339 Identity:81/339 - (23%)
Similarity:128/339 - (37%) Gaps:92/339 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GNDVQVCCPSTAGLGALTHPLLP------------------SDCGKVRWQRSNDTDTRIREF--- 118
            |.:|:..|.:    |..|...||                  .|||::.        |.|::|   
  Fly   319 GTEVKFVCST----GFKTLSPLPEMRCMKGGYWNRGRQRC
EQDCGQLA--------TPIKQFSSG 371

  Fly   119 ---------PWLALIEYTRGNQEKIH-ACGGVLISDRYVLTAAHCVAQAAT------SNLQITAV 167
                     ||...: |...|::..| .|||.|::...|:||||||....|      ...::.|.
  Fly   372 GYTINNTVVPWHVGL-YVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAA 435

  Fly   168 RLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLN 232
            :.......|.|: :...|.::.:.||.|:             .||: ....|:||:.|..|.:|:
  Fly   436 KFYRNYGETTPE-EKRRDVRLIEIAPGYK-------------GRTE-NYYQDLALLTLDEPFELS 485

  Fly   233 DFVQPICLPNKQLRADE--LEDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKYASQQLR-IQA 294
            ..::|||:........|  .:|:..:.|||...:...::.......|...|:|     .|| |||
  Fly   486 HVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSNSVCRR-----NLRDIQA 545

  Fly   295 SKLCGLT--NSQECYGNAGG------PLMLF---KNDGYLLGGLVSFGPVPCPNPDW----PDVY 344
            .|.|..|  .|..|.|::||      |...|   ....:.|.|::|    ..||.|.    ..|.
  Fly   546 DKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVIS----NAPNADQCAHSLTVM 606

  Fly   345 TRVASYIDWIHDSL 358
            |.:..:.|.|.:::
  Fly   607 TNIQHFEDMILNAM 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 2/6 (33%)
Tryp_SPc 111..356 CDD:238113 71/281 (25%)
Tryp_SPc 111..354 CDD:214473 70/279 (25%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 7/38 (18%)
Tryp_SPc 371..616 CDD:214473 67/269 (25%)
Tryp_SPc 371..591 CDD:304450 60/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.