DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG8870

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:384 Identity:112/384 - (29%)
Similarity:177/384 - (46%) Gaps:70/384 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSFPALL-VVVGSLALGANAQLPPINCVAKIPSGRVTGHCISIRECDYFMRILLSGNLSQSDRN 64
            :|||..:| :::...:.||..|...              .|:::.:|.....:     ::.|.:|
  Fly     6 IGSFLLMLQIILVPYSNGAGCQFDT--------------ECVNLDKCPRTRAV-----MNSSRKN 51

  Fly    65 LLRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSD-CGKVRWQRSNDTDTRIREFPWLALIEYTR 128
            ::...:||..    :||||.       ....||.| ||:.|.:.:......:.||||:|::.|..
  Fly    52 IIGLRRCGTN----KVCCPK-------WETYLPHDTCGQSRRKPTKGKIPALNEFPWMAMLLYGN 105

  Fly   129 GN---QEKIHACGGVLISDRYVLTAAHCVAQAATS-NLQITAVRLGEWDTSTNPD-------CQY 182
            .|   |:.:..|||.||::.|||||||||...... ...:..|||||.:||||||       .||
  Fly   106 KNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQY 170

  Fly   183 HEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRA 247
                     ||.|.:|.:::::.|..:|| .|..|||||||||..|.:....:||||||..|..|
  Fly   171 ---------APLYMEIEVDQIITHEQFNR-GRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLA 225

  Fly   248 DELEDLVTEVAGW----QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLC--GLTNSQEC 306
            ......  :.:||    |..:|:.:.:.::.....:.|:..|...    ..|::|  ||..:...
  Fly   226 AHKRKF--QASGWPDMGQGIASEVLLRSFIAERHPDVCKSNYDFN----LGSQICAGGLDGNDTS 284

  Fly   307 YGNAGGPLMLFKNDGYL----LGGLVSFGPVPCP-NPDWPDVYTRVASYIDWIHDSLKA 360
            .|::|||||.....|.:    ..|::|:|..||. ....|..||:.:.:.:||...|::
  Fly   285 PGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKLQS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 7/51 (14%)
Tryp_SPc 111..356 CDD:238113 88/266 (33%)
Tryp_SPc 111..354 CDD:214473 86/264 (33%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 88/262 (34%)
Tryp_SPc 93..337 CDD:214473 86/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.