DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG14088

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:284 Identity:62/284 - (21%)
Similarity:102/284 - (35%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 AGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACG-----GVLISDR 145
            :|.|:.  ..|.:.||:.|...|.|.     ..||.|:          :|..|     |.||.:|
  Fly    19 SGTGSA--QFLGNICGERRDGLSPDI-----VGPWTAI----------LHHFGRIVGVGTLIHER 66

  Fly   146 YVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYN 210
            ::||..||     ..::.:...||||:.         ...|::|      :|..:.....:..:|
  Fly    67 FILTDVHC-----GDSIGVIRARLGEYG---------RIGSELA------EDHIVAAFFSNANFN 111

  Fly   211 RTDRTQINDIALVRLASPAKLNDFVQPICL---PNKQLRADELEDLVTEVAGWQASSSQRMRKGY 272
              ..||.|::.|::|.......:.:.|:|:   ...|..||||:  ......|:.|....|.:..
  Fly   112 --PETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELD--YFNGTTWKNSDKSPMLRSK 172

  Fly   273 VTISSIEECQRKYASQQLRIQASKLC-GLTNSQECYGNAGGPLMLFKNDGYL------LGGLVSF 330
            ..|...:.|.        ::...:.| |..:...|...:|..|.  :...|:      |.|:.:.
  Fly   173 TVIRMPQACG--------KLDHGQFCAGHKDLDSCDEPSGAALT--REIDYIGPNRTVLFGIANS 227

  Fly   331 GPVPCPNPDWPDVYTRVASYIDWI 354
            ..|.|.|   ...||.|.....||
  Fly   228 VEVKCSN---SRTYTDVVQLHQWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 54/259 (21%)
Tryp_SPc 111..354 CDD:214473 52/257 (20%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 54/259 (21%)
Tryp_SPc 42..248 CDD:214473 52/257 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.