DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Jon74E

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:255 Identity:77/255 - (30%)
Similarity:116/255 - (45%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAV-RLG--EWDTS 175
            |..:||:...:.....| :....||..||||||:|||||||.:|......:..| ||.  :...|
  Fly    39 RANQFPYQVGLSIEEPN-DMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRS 102

  Fly   176 TNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICL 240
            |||:...|         |.:...::|                ||||||||...|.|.|.::||.|
  Fly   103 TNPEVHLH---------PDWNCQSLE----------------NDIALVRLPEDALLCDSIRPIRL 142

  Fly   241 PNKQLRADELEDLVTEVAGW------QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCG 299
            |......:..:.:....:||      ..:.|..:|..|..:.|.|:|:..||:    |:.:.:|.
  Fly   143 PGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYAN----IKPTNICM 203

  Fly   300 LT--NSQECYGNAGGPLML---FKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
            .|  ....|.|::||||:.   .:|...|: |:.|:|........:|.|:||:.:|:|||
  Fly   204 DTTGGKSTCTGDSGGPLVYSDPVQNADILI-GVTSYGKKSGCTKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 77/255 (30%)
Tryp_SPc 111..354 CDD:214473 75/253 (30%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.