DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG11529

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:116/253 - (45%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RIREFPWLALIEYTRGNQ--EKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTST 176
            ||.:||:..::   .|.|  .|...|||.|:..|::|||.||     |..:....|.||....  
  Fly    37 RIEKFPYQVML---IGKQLWRKRILCGGTLLDKRWILTAGHC-----TMGVTHYDVYLGTKSV-- 91

  Fly   177 NPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLP 241
                   ||::|:....    :...:.:.|..:|  ..|..||||||:|.........:||..||
  Fly    92 -------EDTEVSGGLV----LRSNKFIVHERFN--PETAANDIALVKLPQDVAFTPRIQPASLP 143

  Fly   242 NKQLRADELEDLVTEVAGWQA----SSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLC--GL 300
            :: .|.|:...:....:||.|    ::|..|:...:.:.|..||.::|..    :.:..:|  ||
  Fly   144 SR-YRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYDV----VTSGVICAKGL 203

  Fly   301 TNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358
            .:...|.|::||||:|  .|..::.|:.||||......:.|..:|||..|:|||...:
  Fly   204 KDETVCTGDSGGPLVL--KDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 73/249 (29%)
Tryp_SPc 111..354 CDD:214473 71/247 (29%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/250 (29%)
Tryp_SPc 37..255 CDD:214473 71/247 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.