DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG18180

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:226 Identity:58/226 - (25%)
Similarity:95/226 - (42%) Gaps:43/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEEL 203
            |.:|::.::||||||:                     |....:.|..|.........|.:..:..
  Fly    68 GTIIANDWILTAAHCL---------------------TGDYVEIHYGSNWGWNGAYRQTVRRDNF 111

  Fly   204 LPHPLY-NRTDRTQINDIALVRLASP-AKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASSSQ 266
            :.||.: ::..|    ||.|:|  :| ...|..:..|.||:...:.|..:|......||....:.
  Fly   112 ISHPDWPSQGGR----DIGLIR--TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNG 170

  Fly   267 RMRKGY----VTISSIEECQRKYASQQLRIQASKLC--GLTNSQECYGNAGGPLMLFKNDGYLLG 325
            .:....    |.|.|..||::.|.|    :.::.:|  .......|.|::||||:  .:|...|.
  Fly   171 NLADWLQCVDVQIISNSECEQAYGS----VASTDMCTRHADGKSVCGGDSGGPLV--THDNARLV 229

  Fly   326 GLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356
            |:::|..|.|  .|.|..||||:.|::||.|
  Fly   230 GVITFASVSC--HDGPSGYTRVSDYLEWIRD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 57/224 (25%)
Tryp_SPc 111..354 CDD:214473 55/222 (25%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 55/222 (25%)
Tryp_SPc 36..259 CDD:238113 58/226 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.