DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:237 Identity:57/237 - (24%)
Similarity:88/237 - (37%) Gaps:63/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 CGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTST-------NPDCQYHEDSKVADCAPP 194
            |||.:|:..:||||.||:..|.:..:...|.    |.|:.       |.:...|..:        
  Fly    65 CGGSIIAHDWVLTAEHCIGDADSVTVYFGAT----WRTNAQFTHWVGNGNFIKHSSA-------- 117

  Fly   195 YQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDF---VQPICLPNKQLRADELEDLVTE 256
                                    ||||:|:...    ||   |..:.||:...|.::..:....
  Fly   118 ------------------------DIALIRIPHV----DFWHMVNKVELPSYNDRYNDYNEWWAV 154

  Fly   257 VAGWQASSSQRMRKGYVTISSIE-----ECQRKYASQQLRIQASKLCGLT--NSQECYGNAGGPL 314
            ..||..:........|:....::     ||...|.|    :..:.||..|  ....|.|::||||
  Fly   155 ACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS----VGDNILCVRTPDGKSTCGGDSGGPL 215

  Fly   315 MLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356
            :  .:||..|.|:.:||.|.......|..:.||..::|||.|
  Fly   216 V--THDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 56/235 (24%)
Tryp_SPc 111..354 CDD:214473 54/233 (23%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 54/233 (23%)
Tryp_SPc 40..256 CDD:238113 57/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.