DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:290 Identity:61/290 - (21%)
Similarity:103/290 - (35%) Gaps:67/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 STAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVL 148
            |.:...::.||...|...|:..:.:|.......:.|:...:.::.|     ..|||.:||:.:||
  Fly    14 SASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGG-----WWCGGSIISNEWVL 73

  Fly   149 TAAHCVAQAAT---------SNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELL 204
            ||.||:...|.         :|.|.|     .|..|.|                         .:
  Fly    74 TAEHCIGGDAVTVYFGATWRTNAQFT-----HWVGSGN-------------------------FI 108

  Fly   205 PHPLYNRTDRTQINDIALVRLASPAKLNDF---VQPICLPNKQLRADELEDLVTEVAGWQASSSQ 266
            .|         ...||||:|:...    ||   |..:.||:...|.::..:......||..:...
  Fly   109 TH---------GSADIALIRIPHV----DFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDG 160

  Fly   267 RMRKGYVTISSIE-----ECQRKYASQQLRIQASKLCGLTNSQECYGNAGGPLMLFKNDGYLLGG 326
            .....|:....::     ||...|.:..:......:..:.....|.|::||||:  .:||..|.|
  Fly   161 SPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLV--THDGSKLVG 223

  Fly   327 LVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356
            :.::..........|..:.||..::|||.|
  Fly   224 VTNWVSGAGCQAGHPAGFQRVTYHLDWIRD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 54/261 (21%)
Tryp_SPc 111..354 CDD:214473 52/259 (20%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 53/264 (20%)
Tryp_SPc 37..254 CDD:238113 56/267 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.