DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG10472

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:302 Identity:83/302 - (27%)
Similarity:128/302 - (42%) Gaps:63/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIRE---FPW-LALIEYTRGNQEK 133
            |:..:::...|...|      ..|||  |::       |..:|.|   ||: :.|:.|..|... 
  Fly    25 VKNLNIETPMPKVHG------ETLPS--GRI-------TGGQIAEPNQFPYQVGLLLYITGGAA- 73

  Fly   134 IHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWD-TSTNPDCQYHEDSKVADCAPPYQD 197
              .|||.:||||:::|||||.....|.    ..|.||..| |:...:.|              |.
  Fly    74 --WCGGTIISDRWIITAAHCTDSLTTG----VDVYLGAHDRTNAKEEGQ--------------QI 118

  Fly   198 IAIE--ELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTE---V 257
            |.:|  .::.|.  :....|..|||:|::|..|.:.|.::||..||   :::|.......|   .
  Fly   119 IFVETKNVIVHE--DWIAETITNDISLIKLPVPIEFNKYIQPAKLP---VKSDSYSTYGGENAIA 178

  Fly   258 AGW------QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTNS--QECYGNAGGPL 314
            :||      ...::..::...|.|.:...|...|..   .:.||.:|..|..  ..|.|::||||
  Fly   179 SGWGKISDSATGATDILQYATVPIMNNSGCSPWYFG---LVAASNICIKTTGGISTCNGDSGGPL 240

  Fly   315 MLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356
            :|......|:|. .|||........||.|:||:..|:|||.:
  Fly   241 VLDDGSNTLIGA-TSFGIALGCEVGWPGVFTRITYYLDWIEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855 1/8 (13%)
Tryp_SPc 111..356 CDD:238113 76/262 (29%)
Tryp_SPc 111..354 CDD:214473 74/260 (28%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 74/269 (28%)
Tryp_SPc 47..282 CDD:238113 76/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.