DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and CG6592

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:256 Identity:72/256 - (28%)
Similarity:114/256 - (44%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 FPWLA--LIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDC 180
            ||:..  |::..:|    ::.|||.||||::|:||||||..|..:     .|.||     .|...
  Fly   134 FPYQVGMLLQRPKG----LYWCGGSLISDKHVITAAHCVDMAKRA-----LVFLG-----ANEIK 184

  Fly   181 QYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQL 245
            ...|..:|....|.      |....:|.:|  .:...:|||:|||......|:.:.||.||.:..
  Fly   185 NAKEKGQVRLMVPS------ENFQIYPTWN--PKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHY 241

  Fly   246 RADELEDLVTEVAGWQASSSQRMRKGYVTISSI-----------EECQRKYASQQLRIQASKLC- 298
            .....::.:...:||     .|...|...||::           ..|:..:   .|..:.:.:| 
  Fly   242 EYRSFKNKLAIASGW-----GRYATGVHAISNVLRYVQLQIIDGRTCKSNF---PLSYRGTNICT 298

  Fly   299 -GLTNSQECYGNAGGPLMLFKNDG--YLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356
             |......|.|::||||:|.:...  .:|.|:.|||.:...:..:|..:|:||||:|||.|
  Fly   299 SGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISD 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 71/254 (28%)
Tryp_SPc 111..354 CDD:214473 69/252 (27%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 69/252 (27%)
Tryp_SPc 123..359 CDD:238113 71/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.