DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:283 Identity:76/283 - (26%)
Similarity:109/283 - (38%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LGALTHPLLPSDC---GKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLT 149
            :.||..|:...|.   .|:..:.:|.......:.|::..:.:..||....: |||.:|...:|||
  Fly    15 VAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWY-CGGSIIGHEWVLT 78

  Fly   150 AAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDR 214
            ||||...|:...:...||    |                               ...|.:...|.
  Fly    79 AAHCTYGASYVTISYGAV----W-------------------------------RQQPQFTHYDT 108

  Fly   215 TQI-NDIALVRLASPAKLNDF---VQPICLPNKQLRADELEDLVTEVAGWQASSSQRMRKGY--- 272
            ..: |||||:|....    ||   |..:.||....|.:........::||.:||.......|   
  Fly   109 GNLHNDIALIRTPHV----DFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNC 169

  Fly   273 --VTISSIEECQRKYASQQLRIQASKLCGLT--NSQECYGNAGGPLMLFKNDGYLLGGLVSFGPV 333
              :.||....|...|.|..  |.::.||..|  |...|.|::||||:|  :||....|:||||..
  Fly   170 VDIQISDNSVCLDYYGSHY--ITSNHLCYATPENKGSCSGDSGGPLVL--HDGNRQVGIVSFGSA 230

  Fly   334 PCPNPDWPDVYTRVASYIDWIHD 356
            .....:.|...|||..|:|||.|
  Fly   231 AGCLSNSPKGLTRVTGYLDWIRD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 69/255 (27%)
Tryp_SPc 111..354 CDD:214473 67/253 (26%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 68/258 (26%)
Tryp_SPc 37..254 CDD:238113 71/261 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.