DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3505 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:300 Identity:73/300 - (24%)
Similarity:120/300 - (40%) Gaps:74/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 STAGLGALTH--PLLPSDC-------GKVRWQRSNDTDTRIREFPWLALIEY--TRGNQEKIHAC 137
            :||..|.|..  |:.|.|.       |::    :|.......:||:...:.:  |.|:    ..|
  Fly    12 ATASAGLLPQQVPIHPRDLPAVTNIEGRI----TNGKTATSGQFPYQVGLSFASTSGS----WWC 68

  Fly   138 GGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEE 202
            ||.:|.:.:|||||||.:.|:...:...|.                    |...|...|.::.:.
  Fly    69 GGSIIDNTWVLTAAHCTSGASAVTIYYGAT--------------------VRTSAQLVQTVSADN 113

  Fly   203 LLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLP----------NKQLRADELEDLVTEV 257
            .:.|..||..  ...|||:|::..:.| ....:..:.||          .:|..|          
  Fly   114 FVQHASYNSI--VLRNDISLIKTPTVA-FTALINKVELPAIAGTYSTYTGQQAIA---------- 165

  Fly   258 AGWQASS------SQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTNSQ--ECYGNAGGPL 314
            :||..:|      :..::.....:.|:.:||..|.|  |....:.:|..|.::  .|.|::||||
  Fly   166 SGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGS--LVATNNVICVATPNKVSTCNGDSGGPL 228

  Fly   315 MLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354
            :|. :|..|: |:.||..........|..:|||.||:|||
  Fly   229 VLV-SDSKLI-GVTSFVSSAGCESGAPAGFTRVTSYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 63/263 (24%)
Tryp_SPc 111..354 CDD:214473 62/262 (24%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 63/271 (23%)
Tryp_SPc 40..269 CDD:238113 64/271 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.